Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G27460-AT5G40550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SGF29 tudor-like domain
Function (paralog2):SGF29 tudor-like domain

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.44512704935711
Log2 mRNA fold difference:0.59180352926682
Log2 TE fold difference:-0.7478187526916
Sequences
Protein sequence

MSSSPDIAGILDNTKELDRLRKEQEEVLVEINKMHKKLQATPEIVEKPGDISLSKLKNLY
IQAKELSESEVTVSNILLTQLDSLLPSGPTGQQRRKLEGNEQKRKRMKVDTDVTRVSPSM
RNQIEAYASLKGEQVAARVTAEDAEKDEWFVVKVIHFDRETKEVEVLDEEPGDDEEGGGQ
RTYKLSMSCILPFPKRNDPSSTQEFIPGKHVLAVYPGTTALYKATVISTPRKRKSDEYLL
EFDDDEEDGALPQRTVPFHKVVALPEGHRQ

MSSPDIVGILENTKELDRLRKDQEEVLVEINKMHKKLQASPEIVEKPGDISLAKLKNLYI
QAKELSENEVTVSNILLTQLDLLLPYGPTGQQRRKLGVVAEGNDQKRKRMKVDSDVIRLS
PSMRNQIEAYASLKGEQVAARVTAESADKDEWFVVKVIHFDRETKEVEVLDEEPGDDEEG
SGQRTYKLPMLCILPFPKRNDPSNTQEFPPGKHVLAVYPGTTALYKATVVSTPRKRKSDE
YLLEFDDDEEDGALPQRTVPFHKVVALPEGHRQ

Other information
Ka divergence:0.404323KaKs divergence:0.306283
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):813Length 2 (bp):822Length divergence:0.006
MFE 1 (kcal):-204.4MFE 2 (kcal):-222.07MFE divergence0.041