Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G27560-AT5G40540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.45806832425202
Log2 mRNA fold difference:0.54471906584227
Log2 TE fold difference:-0.86616373869078
Sequences
Protein sequence

MGSASGFYSNEEFELDPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGES
PEEIAKRDNRFAREIAMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPK
RLDIRLAVGFALDIARAMECLHSHGIIHRDLKPENLILSADHKTVKLADFGLAREESLTE
MMTAETGTYRWMAPELYSTVTLRQGEKKHYNHKVDAYSFAIVLWELILNKLPFEGMSNLQ
AAYAAAFKNLRPSAEDLPGDLEMIVTSCWKEDPNERPNFTEIIQMLLRYLTTVSAPQIIP
PPNRRVFSSENIVLSPESPGTCSLMSVRDGDVSRQTVNTADSSEKQTKGSFFSCCS

MGSVTGFYSNEVFELDPKWVVDPQHLFVGPKIGEGAHAKIYEGKYKNKTVAIKIVKRGES
PEEIAKRESRFAREVSMLSRVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLVSLRPG
SLDIRVAVGYALDIARAMECLHSHGVIHRDLKPESLILTADYKTVKLADFGLAREESLTE
MMTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDAYSFAIVLWELIHNKLPFEGMSNLQ
AAYAAAFKNVRPSADDLPKDLAMIVTSCWKEDPNDRPNFTEIIQMLLRCLSTISSTELVP
PAIKRVFSSENTVLPPESPGTCSLMTVRDKDQIPTDANSAQNEVRGSFFFFCC

Other information
Ka divergence:-0.0969773KaKs divergence:0.230442
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1071Length 2 (bp):1062Length divergence:-0.004
MFE 1 (kcal):-304.06MFE 2 (kcal):-328.21MFE divergence0.038