Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G27630-AT5G40460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.1499782722925
Log2 mRNA fold difference:2.0242012266597
Log2 TE fold difference:0.16765038814365
Sequences
Protein sequence

MGISKKSQVSRELDTDGKKFIFAKTSIRASLKPVKTKLIKPERESEDGICITPTARGAKT
PECPAAPRKRPPVLKCQNNIRIEYFVPPSDFELVFIQRR

MGFSKKSQFEGGLESDGKKWVIAGISIRASLKPVKTKLRAPPEIVTEVEEDCYNEEEECS
TTPTAKETKIPELLECPPAPRKRRPALKCRSNVVREFFTPPSDLETVFLRRR

Other information
Ka divergence:-0.878392KaKs divergence:0.391676
GC content 1 (%):44GC content 2 (%):48GC content divergence:0.043
Length 1 (bp):300Length 2 (bp):339Length divergence:0.061
MFE 1 (kcal):-82.14MFE 2 (kcal):-99.1MFE divergence0.094