Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G28140-AT5G40190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA ligase/cyclic nucleotide phosphodiesterase family protein
Function (paralog2):RNA ligase/cyclic nucleotide phosphodiesterase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.776740803424
Log2 mRNA fold difference:1.1144555803982
Log2 TE fold difference:0.53625157180979
Sequences
Protein sequence

MSQGYAIELYFDPALENQVLKAWNVFARRQISTYLINNESRPHITLFSTTSSIDSTKLEP
IIKSFSSKQEPISLSFSSIGSFSSDDNALFLSPTPSLSLIQLQLQLCEVIKKEGFEIGEE
YRVDSWVPFCSVAVDVPKSRISEGFLVLRDLKLLVYGYAMDIGLVEFSPVREVFSFGLGN
NLES

MSEGYAIELYFDPALENQVLKAWNVFARRQISTKLINTESRPHITLFSTSFFDSTRLESV
IKNFVSKQEPISISFSTIGSFSSDNNVLFLSPTPSLSLLQLQTQLCDMLKKESVDIGEEY
RVDSWVPFCPVALDVPKSRMAEAFSVLRDLKLPVNGYGMEIGLVEFSPVREVFSFPLGNT
LES

www.000webhost.com

Other information
Ka divergence:-0.379282KaKs divergence:0.799557
GC content 1 (%):40GC content 2 (%):44GC content divergence:0.048
Length 1 (bp):555Length 2 (bp):552Length divergence:-0.003
MFE 1 (kcal):-143.46MFE 2 (kcal):-141MFE divergence-0.009