Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G28200-AT5G40150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Peroxidase superfamily protein
Function (paralog2):Peroxidase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.61614810447488
Log2 mRNA fold difference:-0.97147821908871
Log2 TE fold difference:0.27335061149109
Sequences
Protein sequence

MASLKSLFLLFLFFFTAQSRLTTNFYSKTCPRFLDIIRDTITNKQITNPTTAAAVIRLFF
HDCFPNGCDASVLISSTAFNTAERDSSINLSLPGDGFDVIVRAKTALELACPNTVSCSDI
ISVATRDLLITVGGPYYDVFLGRRDSRTSKSSLLTDLLPLPSTPISKIIQQFESKGFTVQ
EMVALSGAHSIGFSHCKEFVGRVGRNNTGYNPRFAVALKKACANYPKDPTISVFNDIMTP
NKFDNMYYQNLKKGLGLLESDHGLYSDPRTRYFVDLYAKNQDLFFKDFAKAMQKLSLFGI
QTGRRGEIRRRCDAIN

MAEQSQLKNLTIILLLLCLSFQSLSFAAESHLTVDFYSKSCPKFLDIIRETITNKQISTP
TTAAAALRLFFHDCFPNGCDASVLVSSTAFNTAERDSSINLSLPGDGFDVVIRAKTALEL
ACPNTVSCSDIIAVAVRDLLVTVGGPYYEISLGRRDSRTSKSSLVSDLLPLPSMQISKLI
DQFSSRGFSVQEMVALSGAHTIGFSHCKEFTNRVNPNNSTGYNPRFAVALKKACSNSKND
PTISVFNDVMTPNKFDNMYFQNIPKGLGLLESDHGLFSDPRTRPFVELYARDQSRFFNDF
AGAMQKLSLHGVLTGRRGEIRRRCDAIN

www.000webhost.com

Other information
Ka divergence:0.0138939KaKs divergence:-0.270807
GC content 1 (%):43GC content 2 (%):50GC content divergence:0.075
Length 1 (bp):951Length 2 (bp):987Length divergence:0.019
MFE 1 (kcal):-233.9MFE 2 (kcal):-261.71MFE divergence0.056