Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G28710-AT3G28715
Species:Arabidopsis
Duplication type:TD
Function (paralog1):ATPase, V0/A0 complex, subunit C/D
Function (paralog2):ATPase, V0/A0 complex, subunit C/D

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.24369208428684
Log2 mRNA fold difference:-0.20924316418212
Log2 TE fold difference:0.39694705547544
Sequences
Protein sequence

MYGFEALTFNIHGGYLEAIVRGHRAGLLTTADYNNLCQCENLDDIKMHLSATKYGSYLQN
EPSPLHTTTIVEKCTLKLVDDYKHMLCQATEPMSTFLEYIRYGHMIDNVVLIVTGTLHER
DVQELIEKCHPLGMFDSIATLAVAQNMRELYRLVLVDTPLAPYFSECLTSEDLDDMNIEI
MRNTLYKAYLEDFYKFCQKLGGATAEIMSDLLAFEADRRAVNITINSIGTELTREDRKKL
YSNFGLLYPYGHEELAICEDIDQVRGVMEKYPPYQAIFSKMSYGESQMLDKAFYEEEVRR
LCLAFEQQFHYAVFFAYMRLREQEIRNLMWISECVAQNQKSRIHDSVVYMF

MYGFEALTFNIHGGYLEAIVRGHRAGLLTTADYNNLCQCENLDDIKMHLSATKYGPYLQN
EPSPLHTTTIVEKCTLKLVDDYKHMLCQATEPMSTFLEYIRYGHMIDNVVLIVTGTLHER
DVQELIEKCHPLGMFDSIATLAVAQNMRELYRLVLVDTPLAPYFSECLTSEDLDDMNIEI
MRNTLYKAYLEDFYNFCQKLGGATAEIMSDLLAFEADRRAVNITINSIGTELTREDRKKL
YSNFGLLYPYGHEELAICEDIDQVRGVMEKYPPYQAIFSKMSYGESQMLDKAFYEEEVRR
LCLAFEQQFHYAVFFAYMRLREQEIRNLMWISECVAQNQKSRIHDSVVYMF

www.000webhost.com

Other information
Ka divergence:-0.0793103KaKs divergence:0.127451
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1056Length 2 (bp):1056Length divergence:0
MFE 1 (kcal):-321MFE 2 (kcal):-333.6MFE divergence0.019