Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G28920-AT5G39760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):homeobox protein 34
Function (paralog2):homeobox protein 23

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.3144697536954
Log2 mRNA fold difference:-2.4458681716668
Log2 TE fold difference:1.1097656148378
Sequences
Protein sequence

MLEVRSMDMTPKSPEPESETPTRIQPAKPISFSNGIIKRHHHHHHNNNKVTYKECLKNHA
AAIGGHALDGCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRETDDSSAVPPPSLLPSST
TTAAIEYQPHHRHHPPPPLAPPLPRSPNSSSPPPISSSYMLLALSGNNKTAPFSDLNFAA
AANHLSATPGSRKRFRTKFSSNQKEKMHEFADRIGWKIQKRDEDEVRDFCREIGVDKGVL
KVWMHNNKNSFKFSGGGATTVQRNDNGIGGENSNDDGVRGLANDGDGGGGRFESDSGGAD
GGGNVNASSSSS

MMDMTPTITTTTTPTPKSPEPESETPTRIQPAKPISFSNGIIKRHHHHHHPLLFTYKECL
KNHAAALGGHALDGCGEFMPSPSSISSDPTSLKCAACGCHRNFHRRDPDNNNDSSQIPPP
PSTAVEYQPHHRHHPPPPPPPPPPRSPNSASPPPISSSYMLLSLSGTNNNNNNLASFSDL
NFSAGNNHHHHHQHTLHGSRKRFRTKFSQFQKEKMHEFAERVGWKMQKRDEDDVRDFCRQ
IGVDKSVLKVWMHNNKNTFNRRDIAGNEIRQIDNGGGNHTPILAGEINNHNNGHHGVGGG
GELHQSVSSGGGGGGFDSDSGGANGGNVNGSSSS

www.000webhost.com

Other information
Ka divergence:-0.205722KaKs divergence:-0.293532
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):939Length 2 (bp):1005Length divergence:0.034
MFE 1 (kcal):-283.12MFE 2 (kcal):-284.79MFE divergence0.003