Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G29100-AT5G39510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):vesicle transport V-snare 13
Function (paralog2):Vesicle transport v-SNARE family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:4.6410903950702
Log2 mRNA fold difference:2.7044868935913
Log2 TE fold difference:1.8661899934582
Sequences
Protein sequence

MEYGSFTVVLYAVDGYFLSTFCSFQVKKMDLEARNLPPNVKSSLLVKLREYKSDLNNFKT
EVKRITSGNLNATARDELLEAGMADTLTASADQRSRLMMSTDHLGRTTDRIKDSRRTILE
TEELGVSILQDLHGQRQSLLRAHETLHGVDDNVGKSKKILTTMTRRMNRNKWTIGAIITV
LVLAIIFILYFKLTR

MSDVFDGYERQYCELSASLSKKCSSAISLDGEQKKQKLSEIKSGLENAEVLIRKMDLEAR
TLPPNLKSSLLVKLREFKSDLNNFKTEVKRITSGQLNAAARDELLEAGMADTKTASADQR
ARLMMSTERLGRTTDRVKDSRRTMMETEEIGVSILQDLHGQRQSLLRAHETLHGVDDNIG
KSKKILTDMTRRMNKNKWTIGAIIIALIAAIFIILYFKLTK

www.000webhost.com

Other information
Ka divergence:-0.315234KaKs divergence:-0.37531
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):588Length 2 (bp):666Length divergence:0.062
MFE 1 (kcal):-157.9MFE 2 (kcal):-185.71MFE divergence0.081