Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G43110-AT5G20790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.2311648113224
Log2 mRNA fold difference:1.3741191237045
Log2 TE fold difference:-4.6456141498349
Sequences
Protein sequence

MATLDSPLEVLAFDYVNFVFNNLWTWIAVVTAAVSFWRIRATTTTTTSGGGRDNGLIDES
FLEPPKPQATKAALLMETKPPRVKVTETEDWSLLLCKDGVTKGKLTVYYEEEIDGEREED
DGETTAVKYGGGESGEWWERWERVVKMRNGDEGWYRYVDLTVINGNVVRLWDANRVRNGG
WVSVQRKECYG

MSTLESPLEALAFEYASLGVFAVVNNVWTWIAVVTAAVSFWRIRVTTIGVGDGHACVLIE
ELTGSKSENESGRLEPKSITGPVKETVARVKETVTKTEPLICDDGVTKGKLTMCYEVDVD
VDGGRCVNGDLTAVSYGGGLGNCGGDWWEKWDGVVRMRNGDDSWYRYVDLTVINGNVVRL
WDDNKTLVTAACV

www.000webhost.com

Other information
Ka divergence:0.0771365KaKs divergence:-0.994125
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):576Length 2 (bp):582Length divergence:0.005
MFE 1 (kcal):-173.3MFE 2 (kcal):-175.4MFE divergence0.006