Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G43220-AT5G20840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phosphoinositide phosphatase family protein
Function (paralog2):Phosphoinositide phosphatase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.3896486903594
Log2 mRNA fold difference:0.059144929071248
Log2 TE fold difference:0.31867659392316
Sequences
Protein sequence

MSSSTDDAGTTTHSLQEFKLFETQSNFYMIGWDGSGVYRVLKIDRLDPSELNISQDSTHY
TKKECYELLKRIHEGNKATGGLKLVTLCYGIIGFVKFLGPYYMLLITERRHIGDLFGHSV
YAVSKSEIVALHNSTVQCNFANSRDENRYKRLLCMVDLTKDFFFSYSYNVMRSYQKNVCN
YETGHNLYEKMFVWNEFLTRGIRHHLRNTLWTVALVYGFFKQASLSESGKDFKITLIARR
SRHNAGTRYLKRGVNRNGDVANDVETEQIVSEDVPEDHPMQISSVVQNRGSIPLFWSQET
SRLNLKPDIVLSKKEPNYEATRLHFDNLVERYGNPIIILNLIKTKERRPRESILREEFVN
AIDFINKDLPEENRLRFLHWDLHKHFRSKTKNVLALLCKVATCALMLTDLFYYQVTPAMT
IEDSMSLSSSSDADTGDISPHTSSDDDNGDHDSLEKKSSRSKNIAYGKCDVKPPRLQSGV
LRTNCIDCLDRTNVAQYAYGWAALGQQLHVLGIRDVPAIELDDPLAISLMGLYERMGDTL
AHQYGGSAAHNKVFSERRGQWRAATQSQEFLRTLQRYYNNAYMDADKQDAINIFLGTFQP
EQGMPAIWELRSNSLSNGRNGEMNIGKDERFLVKRCLSDGDFLHESCTPLSAMSSNHESM
PQKGFSAPLQHVSHILSESSSDIPVSNDVALSRCTPSMPRKQLFGDVQKVHRFGSDQVYF
GGEEDMSSVSNFVDIEWLSSENPCENALFDRSSELTRNLTAETSSTENSVNGVGQSAPTI
SESGSSSSKGKEPMGTKIREDFPDSFKEWVAYGEALCH

MTSSPSVENGGSGSSGSSALLGCMQQFKLFETQANFYMIGWNGSGVYRILKIDRLEASEL
NLREDSTAYTKKECYELLKRIHEGNKATGGLKLVTVCYGIIGFIKFLGPYYMLLITERRE
IGEICGHIVYEVSKSDMIALQHSSVLCNTANLRDENRYKRLLCMVDLTKDFFFSYSYNIM
RSFQKNICDHESGGTLYKKMFVWNEFLTRGTRHHLRNTLWTVALVYGFFKQTILSEAGRN
FKLTLIARRSRHNAGTRYLKRGINESGNVANDVETEQIVSEDVPVDRPMQISSVVQNRGS
IPLFWSQETSRMKVKPDIVLSKRDLNYEATRVHFENLVERYGVPIIILNLIKTNERKPRE
SILRAEFANAIDFINKDLPEENRLRFLHWDLHKHFHSKTENVLALLGKVAACALMLTGFF
YYQLTPAMKLEGYMSLSSSDADTSPHNSSDDDSRDYDSLEKNCRPSKNVANGDYDVKPSR
LQSGVLRTNCIDCLDRTNVAQYAYGWAALGQQLHALGIRDAPTIELDDPLSSTLMGLYER
MGDTLAYQYGGSAAHNKVFSERRGQWRAATQSQEFLRTLQRYYNNAYMDADKQDAINIFL
GTFRPEQGSQAVWELRSDSHSNGRSGEISMGEDEKFLVKRCLSDGNILHESHTPMSAMSR
KNESISHRGFVSSHQVTRTHIISESSPDMPAAGDVTLSRCTPSMPSTHFFGDVQKVQHNG
SSSIYLSEQEDMSSVSNFVDIEWLSSSENLCENDHLSRPSALTIYSTAETSSSENIITEV
KQLTPAMRESGSSSRKGKEPVETELSVHTKIRDDFPDSFKQWVAYGEALCH

Other information
Ka divergence:0.161094KaKs divergence:0.0536913
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2457Length 2 (bp):2496Length divergence:0.008
MFE 1 (kcal):-738.7MFE 2 (kcal):-727.19MFE divergence-0.008