Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G43430-AT5G20885
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.2381236694082
Log2 mRNA fold difference:2.1823062596065
Log2 TE fold difference:-0.32721961368263
Sequences
Protein sequence

MTFFIEDTSLIISHVLYKTALIITVLRWIFAWILRYRSRSSSSSSSQSSSSPSISSQTIK
ESLAVSAFRDAVERSPAAINDMCAVCLGDLEDEDEIRELRNCTHVFHRDCIDRWLDYECC
GGDDDNHRTCPLCRTPLLPSFTDYSTVTQTSWAVERLLYLFGDDLLP

MSFFIEDSGLIVTQLLYKMAVLITVLRWILAWILRYRSRSRSTSSSTSACPSISSQAIKE
SLSVTTFRDAAERSPAMINDTCAVCLGDLEDGDEVRELRNCSHMFHRECIDRWLDYECCG
GDENNEGEEDNHRTCPLCRTPLLAANTTSCGDWPTKNEPSWAVERLLYLFGDDLHV

www.000webhost.com

Other information
Ka divergence:-0.24221KaKs divergence:0.999867
GC content 1 (%):47GC content 2 (%):50GC content divergence:0.031
Length 1 (bp):504Length 2 (bp):531Length divergence:0.026
MFE 1 (kcal):-141MFE 2 (kcal):-175.64MFE divergence0.109