Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G43600-AT5G20960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):aldehyde oxidase 2
Function (paralog2):aldehyde oxidase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.36081442994417
Log2 mRNA fold difference:0.32455734889975
Log2 TE fold difference:-0.62443115498025
Sequences
Protein sequence

MSLVFAINGQRFELELSSVDPSTTLLEFLRYQTSFKSVKLSCGEGGCGACVVLLSKFDPV
LQKVEDFTVSSCLTLLCSVNHCNITTSEGLGNSRDGFHPIHKRLSGFHASQCGFCTPGMS
VSLFSALLDADKSQYSDLTVVEAEKAVSGNLCRCTGYRPIVDACKSFASDVDIEDLGLNS
FCRKGDKDSSSLTRFDSEKRICTFPEFLKDEIKSVDSGMYRWCSPASVEELSSLLEACKA
NSNTVSMKLVAGNTSMGYYKDEREQNYDKYIDITRIPHLKEIRENQNGVEIGSVVTISKV
IAALKEIRVSPGVEKIFGKLATHMEMIAARFIRNFGSIGGNLVMAQRKQFPSDMATILLA
AGAFVNIMSSSRGLEKLTLEEFLERSPLEAHDLVLSIEIPFWHSETNSELFFETYRAAPR
PHGSALAYLNAAFLAEVKDTMVVNCRLAFGAYGTKHAIRCKEIEEFLSGKVITDKVLYEA
ITLLGNVVVPEDGTSNPAYRSSLAPGFLFKFLHTLMTHPTTDKPSNGYHLDPPKPLPMLS
SSQNVPINNEYNPVGQPVTKVGASLQASGEAVYVDDIPSPTNCLYGAFIYSKKPFARIKG
IHFKDDLVPTGVVAVISRKDVPKGGKNIGMKIGLGSDQLFAEDFTTSVGECIAFVVADTQ
RHADAAVNLAVVEYETEDLEPPILSVEDAVKKSSLFDIIPFLYPQQVGDTSKGMAEADHQ
ILSSEIRLGSQYVFYMETQTALAVGDEDNCIVVYSSTQTPQYVQSSVAACLGIPENNIRV
ITRRVGGGFGGKSVKSMPVATACALAAKKLQRPVRTYVNRKTDMIMTGGRHPMKITYSVG
FKSTGKITALELEILIDAGASYGFSMFIPSNLIGSLKKYNWGALSFDIKLCKTNLLSRAI
MRSPGDVQGTYIAEAIIENIASSLSLEVDTIRKINLHTHESLALFYKDGAGEPHEYTLSS
MWDKVGVSSKFEERVSVVREFNESNMWRKRGISRVPIIYEVLLFATPGRVSVLSDGTIVV
EIGGIELGQGLWTKVKQMTSYALGMLQCDGTEELLEKIRVIQSDSLSMVQGNFTGGSTTS
EGSCAAVRLCCETLVERLKPLMERSDGPITWNELISQAYAQSVNLSASDLYTPKDTPMQY
LNYGTAVSEVEVDLVTGQTTVLQTDILYDCGKSLNPAVDLGQIEGSFVQGLGFFMLEEYI
EDPEGLLLTDSTWTYKIPTVDTIPKQFNVEILNGGCHEKRVLSSKASGEPPLLLAASVHC
ATRQAVKEARKQLCMWKGENGSSGSAFQLPVPATMPVVKELCGLDIIESYLEWKLHDNSN
L

MGEKAIDEDKVEAMKSSKTSLVFAINGQRFELELSSIDPSTTLVDFLRNKTPFKSVKLGC
GEGGCGACVVLLSKYDPLLEKVDEFTISSCLTLLCSIDGCSITTSDGLGNSRVGFHAVHE
RIAGFHATQCGFCTPGMSVSMFSALLNADKSHPPPRSGFSNLTAVEAEKAVSGNLCRCTG
YRPLVDACKSFAADVDIEDLGFNAFCKKGENRDEVLRRLPCYDHTSSHVCTFPEFLKKEI
KNDMSLHSRKYRWSSPVSVSELQGLLEVENGLSVKLVAGNTSTGYYKEEKERKYERFIDI
RKIPEFTMVRSDEKGVELGACVTISKAIEVLREEKNVSVLAKIATHMEKIANRFVRNTGT
IGGNIMMAQRKQFPSDLATILVAAQATVKIMTSSSSQEQFTLEEFLQQPPLDAKSLLLSL
EIPSWHSAKKNGSSEDSILLFETYRAAPRPLGNALAFLNAAFSAEVTEALDGIVVNDCQL
VFGAYGTKHAHRAKKVEEFLTGKVISDEVLMEAISLLKDEIVPDKGTSNPGYRSSLAVTF
LFEFFGSLTKKNAKTTNGWLNGGCKEIGFDQNVESLKPEAMLSSAQQIVENQEHSPVGKG
ITKAGACLQASGEAVYVDDIPAPENCLYGAFIYSTMPLARIKGIRFKQNRVPEGVLGIIT
YKDIPKGGQNIGTNGFFTSDLLFAEEVTHCAGQIIAFLVADSQKHADIAANLVVIDYDTK
DLKPPILSLEEAVENFSLFEVPPPLRGYPVGDITKGMDEAEHKILGSKISFGSQYFFYME
TQTALAVPDEDNCMVVYSSTQTPEFVHQTIAGCLGVPENNVRVITRRVGGGFGGKAVKSM
PVAAACALAASKMQRPVRTYVNRKTDMITTGGRHPMKVTYSVGFKSNGKITALDVEVLLD
AGLTEDISPLMPKGIQGALMKYDWGALSFNVKVCKTNTVSRTALRAPGDVQGSYIGEAII
EKVASYLSVDVDEIRKVNLHTYESLRLFHSAKAGEFSEYTLPLLWDRIDEFSGFNKRRKV
VEEFNASNKWRKRGISRVPAVYAVNMRSTPGRVSVLGDGSIVVEVQGIEIGQGLWTKVKQ
MAAYSLGLIQCGTTSDELLKKIRVIQSDTLSMVQGSMTAGSTTSEASSEAVRICCDGLVE
RLLPVKTALVEQTGGPVTWDSLISQAYQQSINMSVSSKYMPDSTGEYLNYGIAASEVEVN
VLTGETTILRTDIIYDCGKSLNPAVDLGQIEGAFVQGLGFFMLEEFLMNSDGLVVTDSTW
TYKIPTVDTIPRQFNVEILNSGQHKNRVLSSKASGEPPLLLAASVHCAVRAAVKEARKQI
LSWNSNKQGTDMYFELPVPATMPIVKEFCGLDVVEKYLEWKIQQRKNV

www.000webhost.com

Other information
Ka divergence:0.0393821KaKs divergence:-0.281947
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3966Length 2 (bp):4107Length divergence:0.017
MFE 1 (kcal):-1236.77MFE 2 (kcal):-1246.72MFE divergence0.004