Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G43700-AT5G21010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):BTB-POZ and MATH domain 6
Function (paralog2):BTB-POZ and MATH domain 5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1157241017678
Log2 mRNA fold difference:0.85450073312363
Log2 TE fold difference:0.17486527557244
Sequences
Protein sequence

MSKLMTRTSGSSSPNTIPDQIESPTSSRSVTQTTNGSHQFVIQGYSLAKGIGVGKHIASD
NFSVGGYQWTIFVYPDGKNPEDNSSYVSVFIVLASECTEVRALFELSLVDQSGKGKHKVH
SHFNRSLDGGPYTLKYRGSMWGYKRFFRRSLLETSDYLKDDCLKINCTVGVVVSEMHCPR
LLSIHVPDSELGSHFGKLLDTLQGSDVTFDVAGEKFQAHKLVLAARSQFFRSMFYNTLAE
NNSDVVISDLEPKVFKALLHFMYKDSLPGDVEPLTAHSFDLLRPSEIDDTLIVKLLAAAE
MYNLSRLRLLCESHICKGISISSVSKILALSDKYNASELKSVSLKFTAENLAAVLQTKAY
EDLKDDCPNLQSELLKAVAGYDDTSSSGGGKSQSVWAQLSNGGETSSRRVRQRTT

MSESVIQGSNPDRVLSPTSSKSVTQTVNGSHQFVIQGYSLAKGMGIGKHIASDNFSVGGY
QWGIFFYPDGKNPEDNSSYVSVFIALASEGTEVRALFELALVDQSGKGKHKVHSHFERSL
DGGPYTLKYRGSMWGYKRFFRRSILETSDYLKDDCLIINCTVGVVVSEILCPQLHSVHVP
DSELGSHFGVLLDSMEGSDITFNIAGEKFLAHKLVLAARSPFFKSKFFSEFEANNTEVTI
NDLEPKVFKALLQFMYKDSLPEDVEPATAHTFERLKLSEIYETLIVKVLAAADKYDLIRL
RLLCESHICKGVSVKSVAKILALADRYNAKELKGVCLKFTAENLAAVLETDAYQQMKDEC
VTLQSELLKAVAGHEEGSNSTGGAKSQSVWAQLSDGGGDTTSRHVRQRTT

www.000webhost.com

Other information
Ka divergence:0.0383918KaKs divergence:-0.0699321
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1248Length 2 (bp):1233Length divergence:-0.006
MFE 1 (kcal):-354.36MFE 2 (kcal):-383.4MFE divergence0.039