Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G43740-AT5G21090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat (LRR) family protein
Function (paralog2):Leucine-rich repeat (LRR) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.5063595154299
Log2 mRNA fold difference:1.9782237757268
Log2 TE fold difference:1.5081776904642
Sequences
Protein sequence

MVAQNSRRELLAASLILTLALIRLTEANSEGDALHALRRSLSDPDNVVQSWDPTLVNPCT
WFHVTCNQHHQVTRLDLGNSNLSGHLVPELGKLEHLQYLYGIITLLPFDYLKTFTLSVTH
ITFCFESYSELYKNEIQGTIPSELGNLKSLISLDLYNNNLTGKIPSSLGKLKSLVFLRLN
ENRLTGPIPRELTVISSLKVVDVSGNDLCGTIPVEGPFEHIPMQNFENNLRLEGPELLGL
ASYDTNCT

MASRNYRWELFAASLTLTLALIHLVEANSEGDALYALRRSLTDPDHVLQSWDPTLVNPCT
WFHVTCNQDNRVTRVDLGNSNLSGHLAPELGKLEHLQYLELYKNNIQGTIPSELGNLKNL
ISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDNRLTGPIPRALTAIPSLKVVDVSSNDLCG
TIPTNGPFAHIPLQNFENNPRLEGPELLGLASYDTNCT

www.000webhost.com

Other information
Ka divergence:0.0845339KaKs divergence:0.610981
GC content 1 (%):41GC content 2 (%):46GC content divergence:0.057
Length 1 (bp):747Length 2 (bp):657Length divergence:-0.064
MFE 1 (kcal):-189.22MFE 2 (kcal):-182.93MFE divergence-0.017