Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G44110-AT5G22060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNAJ homologue 3
Function (paralog2):DNAJ homologue 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.264870439946
Log2 mRNA fold difference:-1.38159295158
Log2 TE fold difference:0.10905818975694
Sequences
Protein sequence

MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE
VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGPFGGNTSRQRRQRRGED
VVHPLKVSLEDVYLGTMKKLSLSRNALCSKCNGKGSKSGASLKCGGCQGSGMKVSIRQLG
PGMIQQMQHACNECKGTGETINDRDRCPQCKGDKVIPEKKVLEVNVEKGMQHSQKITFEG
QADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLL
IKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPDQTKALEAVLPK
PSTAQLSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDDEDDDHPGGAQRVQCAQQ

MFGRGPSRKSDNTKFYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE
VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGSGGHPFGSHSRGRRQRRGE
DVVHPLKVSLEDVYLGTTKKLSLSRKALCSKCNGKGSKSGASMKCGGCQGSGMKISIRQF
GPGMMQQVQHACNDCKGTGETINDRDRCPQCKGEKVVSEKKVLEVNVEKGMQHNQKITFS
GQADEAPDTVTGDIVFVIQQKEHPKFKRKGEDLFVEHTISLTEALCGFQFVLTHLDKRQL
LIKSKPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPESLSPDQTKAIEAVLP
KPTKAAISDMEIDDCEETTLHDVNIEDEMKRKAQAQREAYDDDEEDHPGGAQRVQCAQQ

www.000webhost.com

Other information
Ka divergence:0.395323KaKs divergence:0.367805
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1263Length 2 (bp):1260Length divergence:-0.001
MFE 1 (kcal):-397.3MFE 2 (kcal):-401.19MFE divergence0.005