Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G44260-AT5G22250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Polynucleotidyl transferase, ribonuclease H-like superfamily protein
Function (paralog2):Polynucleotidyl transferase, ribonuclease H-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.8446210861302
Log2 mRNA fold difference:-1.7978335839313
Log2 TE fold difference:-1.0380884896613
Sequences
Protein sequence

MAIIKPNRDLKPDGVTVVTREVWAENLESEFELISEIIDDYPFISMDTEFPGVIFKSDLR
FTNPDDLYTLLKANVDALSLIQVGLTLSDVNGNLPDLGDDLHRGFIWEFNFRDFDVARDA
HAPDSIELLRRQGIDFERNCRDGVESERFAELMMSSGLVCNEEVSWVTFHSAYDFGYLMK
ILTRRELPGALGEFKRVMRVLFGERVYDVKHMMKFCERRLFGGLDRVARTLEVNRAVGKC
HQAGSDSLLTWHAFQRMRDLYFVQDGPEKHAGVLYGLEVF

MIKSEADLSDVIVIRDVWAYNLESEFDLIRGIVEDYPFISMDTEFPGVIYKADLDVLRRG
NPNYLYNLLKSNVDALSLIQVGLTLSDADGNLPDLGGQKNRRYIWEFNFRDFDVERDPHA
PDSIELLRRHGIDFERNRREGVESERFAELMMSSGLICNESVSWVTFHSAYDFGYLVKIL
TRRQLPVALREFLGLLRAFFGDRVYDVKHIMRFCEQRLYGGLDRVARSLEVNRAVGKCHQ
AGSDSLLTWQAFQRMRDLYFVEDGAEKHAGVLYGLEVF

www.000webhost.com

Other information
Ka divergence:0.174353KaKs divergence:0.307909
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):843Length 2 (bp):837Length divergence:-0.004
MFE 1 (kcal):-299MFE 2 (kcal):-296.1MFE divergence-0.005