Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G44280-AT5G22280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.7262892991957
Log2 mRNA fold difference:1.5276224112936
Log2 TE fold difference:0.040315562324609
Sequences
Protein sequence

MSKPVLLVCLLVILIVTSQFEWRQPLVELDTATSSSQKQQQISDREEAVKEKIIISQERH
IQRLNELVRSLQLQLLQCKGENETQNATKSYHINKQFIEVERKQILEG

MSRPIMLVFLLVILIVTSQFEWRQPLLELDAAPSLSQKHQQIAKREEAVKEKMRLVEKHR
LIGLATLKFHWMYDEPHNFSIILNLKIEEDLSILSLLIVTDHLVTRETYPEAKRPCTKSS
NAVTAMQRRERDTKRH

Other information
Ka divergence:0.339647KaKs divergence:0.325123
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):327Length 2 (bp):411Length divergence:0.114
MFE 1 (kcal):-75.3MFE 2 (kcal):-95.82MFE divergence0.12