Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G44300-AT5G22300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nitrilase 2
Function (paralog2):nitrilase 4

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.6169484413883
Log2 mRNA fold difference:-2.1535813488236
Log2 TE fold difference:-0.76239821315399
Sequences
Protein sequence

MSTSENTPFNGVASSTIVRATIVQASTVYNDTPATLEKANKFIVEAASKGSELVVFPEAF
IGGYPRGFRFGLGVGVHNEEGRDEFRKYHASAIKVPGPEVEKLAELAGKNNVYLVMGAIE
KDGYTLYCTALFFSPQGQFLGKHRKLMPTSLERCIWGQGDGSTIPVYDTPIGKLGAAICW
ENRMPLYRTALYAKGIELYCAPTADGSKEWQSSMLHIAIEGGCFVLSACQFCLRKDFPDH
PDYLFTDWYDDKEPDSIVSQGGSVIISPLGQVLAGPNFESEGLITADLDLGDVARAKLYF
DSVGHYSRPDVLHLTVNEHPKKPVTFISKVEKAEDDSNK

MSMQQETSHMTAAPQTNGHQIFPEIDMSAGDSSSIVRATVVQASTVFYDTPATLDKAERL
LSEAAENGSQLVVFPEAFIGGYPRGSTFELAIGSRTAKGRDDFRKYHASAIDVPGPEVER
LALMAKKYKVYLVMGVIEREGYTLYCTVLFFDSQGLFLGKHRKLMPTALERCIWGFGDGS
TIPVFDTPIGKIGAAICWENRMPSLRTAMYAKGIEIYCAPTADSRETWLASMTHIALEGG
CFVLSANQFCRRKDYPSPPEYMFSGSEESLTPDSVVCAGGSSIISPLGIVLAGPNYRGEA
LITADLDLGDIARAKFDFDVVGHYSRPEVFSLNIREHPRKAVSFKTSKVMEDESV

www.000webhost.com

Other information
Ka divergence:-0.553067KaKs divergence:0.0491695
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1020Length 2 (bp):1068Length divergence:0.023
MFE 1 (kcal):-324.5MFE 2 (kcal):-335.81MFE divergence0.017