Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G44720-AT5G22630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):arogenate dehydratase 4
Function (paralog2):arogenate dehydratase 5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.6568522784217
Log2 mRNA fold difference:-0.70518197507333
Log2 TE fold difference:0.067505916125053
Sequences
Protein sequence

MQAATSCDLKFRSTDPTSRNKCFSHAIPKRVAVTCGYRSESFSFPNGVSVSRSDWQSSCA
ILSSKVASVENTGGLADKIAAVNGHTNGSVNLGLVAVESTNGKLAPAQPLTITDLSPAPL
HGSSLRVAYQGVPGAYSEAAAGKAYPNCDAIPCDQFDVAFQAVELWIADRAVLPVENSLG
GSIHRNYDLLLRHRLHIVGEVQIPVHHCLLALPGVRTDCVSRVISHPQALAQTEHSLDVL
TPHAAREAFHDTAAAAEYISANDLHDTAAVASARAAELYNLQILADGIQDDPGNVTRFLM
LAREPIIPRTDRPFKTSIVFAAQEHKGTSVLFKVLSAFAFRDISLTKIESRPHHNRPLRV
VGDGSFGTSKNFEYMFYVDFEASMAEPRAQNALAEVQEYTSFLRVLGSYPMDMTPWSMTS
TEEA

MQTISPAFSCDLKSVIQPNLTAKKARYSHVNGKRVSVRCSYRSESFSFPNGVGSSRADWQ
SSCAILASKVVSAENSSSVAVVNGHSNGSVDLSLVPSKSQHNGKPGLIQPLTITDLSPAP
SHGSTLRVAYQGVPGAYSEAAAGKAYPNSEAIPCDQFDVAFQAVELWIADRAVLPVENSL
GGSIHRNYDLLLRHRLHIVGEVQIPVHHCLLALPGVRTDCITRVISHPQALAQTEGSLNK
LTPKAAIEAFHDTAAAAEYIAANNLHDTAAVASARAAELYGLQILADGIQDDAGNVTRFL
MLARDPIIPRTDRPFKTSIVFAAQEHKGTSVLFKVLSAFAFRNISLTKIESRPHQNCPVR
VVGDENVGTSKHFEYTFYVDFEASMAEARAQNALAEVQEYTSFLRVLGSYPMDMTPWSTL
PSEDV

www.000webhost.com

Other information
Ka divergence:-0.168348KaKs divergence:0.083682
GC content 1 (%):53GC content 2 (%):52GC content divergence:-0.01
Length 1 (bp):1275Length 2 (bp):1278Length divergence:0.001
MFE 1 (kcal):-462.7MFE 2 (kcal):-454.14MFE divergence-0.009