Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G44750-AT5G22650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):histone deacetylase 3
Function (paralog2):histone deacetylase 2B

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.2641057346495
Log2 mRNA fold difference:0.66581922907125
Log2 TE fold difference:0.65936783794495
Sequences
Protein sequence

MEFWGIEVKSGKPVTVTPEEGILIHVSQASLGECKNKKGEFVPLHVKVGNQNLVLGTLST
ENIPQLFCDLVFDKEFELSHTWGKGSVYFVGYKTPNIEPQGYSEEEEEEEEEVPAGNAAK
AVAKPKAKPAEVKPAVDDEEDESDSDGMDEDDSDGEDSEEEEPTPKKPASSKKRANETTP
KAPVSAKKAKVAVTPQKTDEKKKGGKAANQSPKSASQVSCGSCKKTFNSGNALESHNKAK
HAAAK

MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQD
KFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTA
VTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDE
DDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEE
KKKGGHTATPHPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKG
KGKGRA

Other information
Ka divergence:0.294034KaKs divergence:0.482924
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):738Length 2 (bp):921Length divergence:0.11
MFE 1 (kcal):-218.7MFE 2 (kcal):-279.7MFE divergence0.122