Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G44850-AT5G22840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.24225395495716
Log2 mRNA fold difference:-0.0062489279238014
Log2 TE fold difference:0.39926430143571
Sequences
Protein sequence

MAEDKNNGRVNDESEYSSEDEGTEDYKKGGYHTVRVGDTFKNGAYVIQSKLGWGHFSTVW
LAWDTQESRYVALKVQKSAQHYTEAAMDEIKILKQIAEGDSGDKKCVVKLLDHFKHTGPN
GKHVCMVFEYLGDNLLSVIKYSDYRGVPLHMVKELCFHILVGLDYLHRELSIIHTDLKPE
NVLLLSTIDPSRDVRRSGVPLVLPITKDKIVSESAVKPETKSYTYNGDLTKNQKKKIRKK
AKKVVAQDFGGEEALEESERDSNSEARINGNSTVERSEGSSTRLMEGEEAREKANKKNGR
GSRRGSRSTRQKLLSDIECKCKLVDFGNACWTYKQFTSDIQTRQYRCPEVVLGSKYSTSA
DMWSFACICFELATGDVLFDPHSGENYDRDEDHLALMMELLGMMPRKIALGGRYSRDFFN
RQGELRHIRRLRFWPISKVLKEKYDFSEQDAKDMSDFLVTILEFVPEKRPTAAQCLKHPW
FNPGPRLLEPSLKPQQPKGEEEGAANENIEKEKDEREAMEAGVGNIAIDVSEPK

MADEKNGGRLSDASDYSSEDEGTEDYRRGGYHTVRVGDTFKNGSYVIQSKLGWGHFSTVW
LAWDTLNSRYVALKIQKSAQHYTEAAMDEIKILKQIAEGDAEDKKCVVKLLDHFKHAGPN
GQHVCMVFEYLGDNLLSVIKYSDYRGVPLHMVKEICFHILVGLDYLHRELSIIHTDIKPE
NILLCSTIDPEADARKSGIPLVLPTVKDKAVPERPVEKEKPKSYTYSADLTKNQKKKIRK
KAKKVEGSEENERDSSNSEARPNGNATVERLEESSERVKDAENVSQKSRGNRRGSQSTRQ
KLLADVDRKCKLVDFGNACWTYKQFTSDIQTRQYRCPEVVLGSKYSTSADMWSFACICFE
LATGDVLFDPHSGENFERDEDHLALMMELLGMMPRKIALGGRHSRDFFNRQGELRHIRRL
RFWPLSKVLTDKYDFSEEDAIAMQDFITPILQFVPEKRPTAAQCLTHPWLNPVPKSLKPS
SSPQNPKEEEEEASDEDKDKEKVEREAMEAGVGNIAIDGSERKTSAREGRQSARDLRT

www.000webhost.com

Other information
Ka divergence:0.0980628KaKs divergence:0.137056
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1605Length 2 (bp):1617Length divergence:0.004
MFE 1 (kcal):-453.38MFE 2 (kcal):-488.76MFE divergence0.038