Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G44940-AT5G22930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1635)
Function (paralog2):Protein of unknown function (DUF1635)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.083108937261525
Log2 mRNA fold difference:1.1450452563536
Log2 TE fold difference:-1.2752208478905
Sequences
Protein sequence

MDQSNSLLSWTYFSHGKTTEELRQTLVYTTMELEQTKLVAHEELRKRDEQLIHLEDVLTK
TLKERDEALEKYNHLLLNNLLLQQKQQQNQNQKQELVTPPLSGASSIIEDEQVQPQQPQL
NSNKSFSSSDTEESIMSPSVIDPVTMNQQIEVSGDEMLATLLPDKPLPEKGKLLQAVIKA
GPLLQTLLLAGPLPQWRHPPPPLETSEIPPVTIPLPQFQNNGCGNSNKKRAFSISDETYS
ETKYQKVLLH

MDNQSNALLGWPYYSHAKTTEEIRQSLLYTTLELDQTKMFAYEEIRKRDEQLIHLKDILT
KTIKERDEALEKCQRLMFDSHSLQQQKHMTPPLSGASSIEDEQVQPQQLRSNKSFSSSDC
EESIMSPTDHIMNPPPCQLEEVSGTEIIMDPLLQDKPLPEKGKLLQAVIKAGPLLQTLLL
AGPLPQWRHPPPPLKSFEIPPVTVQCPIVNNGCGKFNRKRVFSDGSYSEAKYQKVLLQ

www.000webhost.com

Other information
Ka divergence:-0.00187986KaKs divergence:-0.355858
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):753Length 2 (bp):717Length divergence:-0.024
MFE 1 (kcal):-193.95MFE 2 (kcal):-186.7MFE divergence-0.019