Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G45210-AT5G60680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function, DUF584
Function (paralog2):Protein of unknown function, DUF584

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1805447312861
Log2 mRNA fold difference:0.76780799039829
Log2 TE fold difference:0.39391305554643
Sequences
Protein sequence

MATATRKSYYQRPSHRFLPTDRTYNVTGDSEFEFDESDLYSNRSDSPEFRRKLITSNRKS
SPATVTTTTVASSLPMNVQNWSKILGKENRKSIENDDDGGEGKLPPHEYLAKTRMASFSV
HEGIGRTLKGRDMSRVRNAILEKTGFLD

MATGKSYYARPSYRFLGTDQPSYFTASDSGLEFDESDLFNPIHSDSPDFCRKISSSVRSG
KKSSNRPSAASSAAAASSLPVNVPDWSKILRGEYRDNRRRSIEDNDDDDDDNEDGGDWLP
PHEFLAKTRMASFSVHEGVGRTLKGRDLSRVRNAIFEKFGFQD

Other information
Ka divergence:-0.371315KaKs divergence:0.0276435
GC content 1 (%):46GC content 2 (%):50GC content divergence:0.042
Length 1 (bp):447Length 2 (bp):492Length divergence:0.048
MFE 1 (kcal):-132.8MFE 2 (kcal):-154.29MFE divergence0.075