Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G45240-AT5G60550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):geminivirus rep interacting kinase 1
Function (paralog2):geminivirus rep interacting kinase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.64832853087165
Log2 mRNA fold difference:-0.41472780549085
Log2 TE fold difference:1.1289780767101
Sequences
Protein sequence

MFCDSFAFAQVMSCFGCFGGSERSRHSPNPYDDDTYSHDSGETSNPGGDDEEGEEEEEVE
ELSRSKRSEEILKCKLQNGLVCRQFPVKETNKLTRGEDEDGNKTINEFVRERKIGSGSYG
KVVLYRSTVDDKHYAIKAFHKSHLSRLRVAPSETAMGDVLREVMIMKTLEHPNIVNLIEV
IDDPEFDDFYMVLEYVDGKWAYDDSGPPGALGEITARKYLRDVVAGLMYLHAHNVIHGDI
KPDNLLVTSTGRVKIGDFSVSQVFKDDDDQLRRSPGTPVFTAPECCLGITYSGRSADTWA
VGVTLYCMILGQYPFLGDTLQDTYDKIVHNPLIIPEGLNPRLRDLIEGLLCKDPNQRMTL
KAVAEHPWITGEDGAISEYCCWCKRKAEEEEDQNHS

MFRDSFLFARTIGCFGCFGSSGSRNQQSPKPYDDDTHSCDSDVTSTARGEEEEDEEEVEQ
KSRSKRSEEILKYRLDNGLICRHIPVRETNELIRGEDENGDKTINEYVRVCKIGSGSYGK
VVLYRSTLDGQYYAIKAFHKSHLLRLRVAPSETAMSDVLREVMIMKILEHPNIVNLIEVI
DDPETDHFYMVLEYVDGKWVYDGSGPPGALGEKTARKYLRDIVTGLMYLHAHDVIHGDIK
PDNLLVTSSGTVKIGDFSVSQVFKDDDDQLRRSPGTPVFTAPECCLVSGITYSGRAADTW
AVGVTLYCMILGQYPFLADTLQDTYDKIVNNPLIIPDGLNPLLRDLIEGLLCKDPSQRMT
LKNVSEHPWVIGEDGHVPEYFCWCKRNAASKIEEGEANGISETSDPN

Other information
Ka divergence:-0.247141KaKs divergence:-0.142752
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1191Length 2 (bp):1224Length divergence:0.014
MFE 1 (kcal):-332.83MFE 2 (kcal):-359.81MFE divergence0.039