Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G45310-AT5G60360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cysteine proteinases superfamily protein
Function (paralog2):aleurain-like protease

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.3069025975876
Log2 mRNA fold difference:3.2790143010339
Log2 TE fold difference:-0.0021210996828251
Sequences
Protein sequence

MSVKLNLSSSILLILFAAAASKEIGFDESNPIKMVSDNLHELEDTVVQILGQSRHVLSFS
RFTHRYGKKYQSVEEMKLRFSVFKENLDLIRSTNKKGLSYKLSLNQFADLTWQEFQRYKL
GAAQNCSATLKGSHKITEATVPDTKDWREDGIVSPVKEQGHCGSCWTFSTTGALEAAYHQ
AFGKGISLSEQQLVDCAGTFNNFGCHGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGGCKF
SAKNIGVQVRDSVNITLGAEDELKHAVGLVRPVSVAFEVVHEFRFYKKGVFTSNTCGNTP
MDVNHAVLAVGYGVEDDVPYWLIKNSWGGEWGDNGYFKMEMGKNMCGVATCSSYPVVA

MSAKTILSSVVLVVLVAASAAANIGFDESNPIRMVSDGLREVEESVSQILGQSRHVLSFA
RFTHRYGKKYQNVEEMKLRFSIFKENLDLIRSTNKKGLSYKLGVNQFADLTWQEFQRTKL
GAAQNCSATLKGSHKVTEAALPETKDWREDGIVSPVKDQGGCGSCWTFSTTGALEAAYHQ
AFGKGISLSEQQLVDCAGAFNNYGCNGGLPSQAFEYIKSNGGLDTEKAYPYTGKDETCKF
SAENVGVQVLNSVNITLGAEDELKHAVGLVRPVSIAFEVIHSFRLYKSGVYTDSHCGSTP
MDVNHAVLAVGYGVEDGVPYWLIKNSWGADWGDKGYFKMEMGKNMCGKYCYMCIIPRCGL
R

www.000webhost.com

Other information
Ka divergence:0.0843635KaKs divergence:0.487445
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1077Length 2 (bp):1086Length divergence:0.004
MFE 1 (kcal):-337.8MFE 2 (kcal):-339.1MFE divergence0.002