Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G45590-AT5G60230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):splicing endonuclease 1
Function (paralog2):splicing endonuclease 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.4219532938721
Log2 mRNA fold difference:-1.0402834916117
Log2 TE fold difference:2.4215875250829
Sequences
Protein sequence

MAPRWKWKGAEAKALAEPVSKTVSELRSSLTQTEALGFLSSCNVLLSVESEEAELLDRCC
FGRLVVGAEKDKRWIQLSFEEAFFLFYKLKCIKICLHGRSLENEVDLWRSMSSFKQDFAI
LYKAYSHLRSKNWIVRSGLQYGVDFVVYRHHPSLVHSEYAVLVQSIGGNDRLKVWSDIHC
SVRLTGSVAKSLLVLYVNRKVNTEKMNLPLCLEDYTVEEQTIRRWSPELSREDETRT

MQLNSMAPRWKWKGAEAKALAEPISKSVSELQLSLAETESSGTLSSCNVLLAVEPEQAEL
LDRCCFGRLVLSAEKIKKWIQLSFEEAFFLHYNLKCIKISLQGRCLENEVDTWLYMKSKR
PNFPMFFKAYSHLRSKNWVLRSGLQYGVDFVAYRHHPSLVHSEYSVLVQSGDSDRLRVWS
DIHCAVRLSGSVAKTLLTLYVNGNFKGEDVNLLVCLENFTVEEQTISRWSPELSREDQST
NSKQHVPNVSNLNTL

Other information
Ka divergence:-0.171416KaKs divergence:0.462864
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):714Length 2 (bp):768Length divergence:0.036
MFE 1 (kcal):-208.62MFE 2 (kcal):-217.39MFE divergence0.021