Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G45630-AT5G60170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA binding (RRM/RBD/RNP motifs) family protein
Function (paralog2):RNA binding (RRM/RBD/RNP motifs) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.29165187515708
Log2 mRNA fold difference:0.73479003507893
Log2 TE fold difference:-0.37040196327611
Sequences
Protein sequence

MSDYGEKTCPLCAEEMDLTDQQLKPCKCGYQICVWCWHHIMDMAEKDQSEGRCPACRTPY
DKEKIVGMTVDQERLASEGNMDRKKIQKSKPKSSDGRKPLTSVRVVQRNLVYIVGLPLNL
ADEDLLQRKEYFGQYGKVLKVSMSRTATGLIQQFPNNTCSVYITYGKEEEAIRCIQSVHG
FILDGKALKACFGTTKYCHAWLRNVACNNQDCLYLHEVGSQEDSFTKDEIISAHTRVQQI
TGATNTMQYRSGSMLPPPLDAYTSDSSTGNPIAKVPSSTSVSAPKSSPPSGSSGKSTALP
AAASWGARLTNQHSLATSALSNGSLDNQRSTSENGTLATSTVVTKAANGPVSSSNSLQKA
PLKEEIQSLAEKSKPGVLKPLQQKIVLDPESKRTTSPNRDPSSNQISCLVESSYNSRVID
KPSAVENSLEHTSEIAEDVFDVGKLSADVAWMGITTNSRDETPGVPVVIGTHCDLGSITQ
SDNDVQNLEQCRKQSPTNTYAEADISLNGIHGSRPEWDWRSGLQSQIDVKEPLEVNDFSS
FNNNRRGIAEAVSHSTSKFSSSISILDSNHLASRSFQNRETSCGMDSKTGSSFEIGSDRL
HLPNGFSEKAMSNMEHSLFANEGRSNIQNTEDDIISNILDFDPWDESLTSQHNFAKLLGQ
SDHRASTLESSNLLKQHNDQSRFSFARHEESNSQAYDNRSYSIYGQLSRDQPLQEFGANR
DMYQDKLGSQNGFASNYSGGYEQFATSPGLSSYKSPVARTQVSAPPGFSAPNRLPPPGFS
SHQRGDLSSDIASGTRLLDSANLLRNAYHVPPPSGNLNAAGDIEFIDPAILAVGRGRLHN
GMETADFDLRSGFSSQLNSFDNDARLQLLAQRSLAAQQVNGFHDPRNVNNFSSSFSDPYG
ISSRPTDQTQGTGLSPFTQLPRQASANPLLSNGHWDNKWNEPQSGNNLGITQLLRNERMG
FNDNVYSGFEEPKFRRPGPGDPYNRTYGI

MSDHGEKTCPLCAEEMDLTDQQLKPCKCGYQICVWCWHHIVDMAEKDQIEGRCPACRTPY
DKEKIVGMTVNCDSLASEGNMERKKIQKSKSKSSEGRKQQLTSVRVIQRNLVYIVGLPLN
LADEDLLQHKEYFGQYGKVLKVSMSRTASGVIQQFPNNTCSVYITYGKEEEAVRCIQAVH
GFILDGKPLKACFGTTKYCHAWLRNVACVNPDCLYLHEVGSQDDSFTKDEIISAYTRSRV
QQITGATNILQHHSGNMLPPPLDAYCSDSSSAKPIIKVPSTNATSVPRYSPPSGSGSSSR
STALPAAASWGTHQSLATSVTSNGSSDIQRSTSVNGTLPFSAVVANAAHGPVSSNDILKR
PSRKEESQIVMDKVKPSVLKPLQHNVVVSGSERITAPDRDPTSNRLSSSVDSAYGGRDID
QPSAYSGRDIDKPSSTVSSFDAANEAVEDVPTVSNLLDGVACMRITMNCRDERPDITMAI
GSQSDQGSIRQPGSEVSKLPDLEQCRIDSSINTDKKAISLEDRIPRTRPGWDWISDLQSQ
MQGSSKLQVEDISTLDSQRPHPEEDIIHSRLLSNLSSSSLDTNHMASRSSLPCEVRGSDR
LHLPNGFGEKSMSSVEHSLFANEGRNKVNNAEDAILSNILSLDFDPWDESLTSPHNLAEL
LGEVDQRSSTLKPSNFLKQHNNQSRFSFARYEESSNQAYDSENYSIYGQLSRDKPIQESA
MSRDIYRNNLGSVNGFASNFAGGLDNFAASPLFSSHKNPVSRPQVSAPPGFSAPNRLPPP
GFSSHERVGLSSDTTLGNRFLDSTSLRNAYQVPPPVGNSNGASDIDFVDPAILAVGRGMV
NADLDMRSGFSSQLNSFENETGLHMLRQQSLSSAQQVNGFHHDLRNLSPSLNDPYGFSSR
LMDQTQGSSLSPFSQLPRQQPSANSILSNGHHWDKWNEGQSVNNIGMAELLRNERLGFNG
SLYNNGYEEPKFRIPSPGDVYNRTYGI

www.000webhost.com

Other information
Ka divergence:-0.0928459KaKs divergence:-0.210406
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2970Length 2 (bp):2964Length divergence:-0.001
MFE 1 (kcal):-883.05MFE 2 (kcal):-873.25MFE divergence-0.006