Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G45930-AT5G59970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Histone superfamily protein
Function (paralog2):Histone superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1996998963821
Log2 mRNA fold difference:1.1157307792831
Log2 TE fold difference:0.10117812255652
Sequences
Protein sequence

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
IFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
IFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):48GC content 2 (%):51GC content divergence:0.03
Length 1 (bp):312Length 2 (bp):312Length divergence:0
MFE 1 (kcal):-100.36MFE 2 (kcal):-100.1MFE divergence-0.001