Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G45960-AT3G45970
Species:Arabidopsis
Duplication type:TD
Function (paralog1):expansin-like A3
Function (paralog2):expansin-like A1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:4.0491502015947
Log2 mRNA fold difference:0.3394656450371
Log2 TE fold difference:4.2540745366763
Sequences
Protein sequence

MRSFLYLIVVIFLFSSSVNACDRCLHRSKASYFSSASALSSGACAYGPMATSFFAGHIAA
AIPSIYKDGAGCGACFQVRCKNPKLCNSKGTIVMVTDLNTSNQTDLVLSSRAFRAMAKPV
VGVDKYLLKQGIVDVEYQRVPCNYGKRNLNVRVEEASKKPNYLAIKLLYQGGQTEVVGID
IAPVGSSQWSYMSRSHGAVWATDKVPTGALQFKFTVTGGYDGKTVWSKRVLPANWNSGRI
YDAGVQITDIAQEGCDTCGHIWN

MGSFLFLIVVIFLFSSSVNACDRCLHRSKAAYFSSASALSSGACAYGSMATSFFAGHIAA
AIPSIYKDGAGCGACFQVRCKNPKLCSTKGTIVMITDLNKSNQTDLVLSSRAFRAMAKPI
VGADKDLLKQGIVDIEYQRVPCDYGNKNMNVRVEEASKKPNYLEIKLLYQGGQTEVVSID
IAQVGSSPNWGYMTRSHGAVWVTDKVPTGAIQFRFVVTGGYDGKMIWSQSVLPSNWEAGK
IYDAGVQITDIAQEGCDPCDAHIWN

www.000webhost.com

Other information
Ka divergence:-0.146542KaKs divergence:-0.999877
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):792Length 2 (bp):798Length divergence:0.004
MFE 1 (kcal):-249.71MFE 2 (kcal):-223.06MFE divergence-0.056