Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G45980-AT3G46030
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Histone superfamily protein
Function (paralog2):Histone superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.1983917679007
Log2 mRNA fold difference:0.21997886999058
Log2 TE fold difference:-0.35020115103579
Sequences
Protein sequence

MAPRAEKKPAEKKPAAEKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSV
ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYNKKPTITSREI
QTAVRLVLPGELAKHAVSEGTKAVTKFTSS

MAPKAEKKPAEKKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSVETYKI
YIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYNKKPTITSREIQTAVR
LVLPGELAKHAVSEGTKAVTKFTSS

Other information
Ka divergence:-1KaKs divergence:-0.986667
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):453Length 2 (bp):438Length divergence:-0.017
MFE 1 (kcal):-133MFE 2 (kcal):-120.24MFE divergence-0.05