Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46000-AT5G59890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):actin depolymerizing factor 2
Function (paralog2):actin depolymerizing factor 4

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.13579631716225
Log2 mRNA fold difference:0.09009469996826
Log2 TE fold difference:0.11160884968188
Sequences
Protein sequence

MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDKQVIVEKLGEPEQSYDDFAASLPA
DDCRYCIYDFDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVELQ
ATDPTEMGLDVFKSRTN

MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASL
PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE
LQATDPTEMDLDVLKSRVN

Other information
Ka divergence:-0.0357435KaKs divergence:-0.10122
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):414Length 2 (bp):420Length divergence:0.007
MFE 1 (kcal):-110MFE 2 (kcal):-124.31MFE divergence0.061