Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46030-AT5G59910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Histone superfamily protein
Function (paralog2):Histone superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.200645591576
Log2 mRNA fold difference:0.79590739402907
Log2 TE fold difference:0.4000348695439
Sequences
Protein sequence

MAPKAEKKPAEKKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSVETYKI
YIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYNKKPTITSREIQTAVR
LVLPGELAKHAVSEGTKAVTKFTSS

MAPKAEKKPAEKKPASEKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSV
ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSREI
QTAVRLVLPGELAKHAVSEGTKAVTKFTSS

Other information
Ka divergence:-1KaKs divergence:-0.999993
GC content 1 (%):45GC content 2 (%):49GC content divergence:0.043
Length 1 (bp):438Length 2 (bp):453Length divergence:0.017
MFE 1 (kcal):-120.24MFE 2 (kcal):-146MFE divergence0.097