Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46040-AT5G59850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ribosomal protein S15A D
Function (paralog2):Ribosomal protein S8 family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.373343606655
Log2 mRNA fold difference:1.0789919676569
Log2 TE fold difference:0.27336837082071
Sequences
Protein sequence

MVRISVLNDGLKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGK
IVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGFIVLTTSAGIMDHEEARRKN
VGGKVLGFFY

MVRISVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGK
IVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKN
VGGKVLGFFY

www.000webhost.com

Other information
Ka divergence:-1KaKs divergence:-0.987654
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):393Length 2 (bp):393Length divergence:0
MFE 1 (kcal):-114MFE 2 (kcal):-127.5MFE divergence0.056