Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46060-AT5G59840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RAB GTPase homolog 8A
Function (paralog2):Ras-related small GTP-binding family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0351614292098
Log2 mRNA fold difference:-0.8872066259685
Log2 TE fold difference:-0.12919159947964
Sequences
Protein sequence

MAAPPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELD
GKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDN
VNKILVGNKADMDESKRAVPTAKGQALADEYGIKFFETSAKTNLNVEEVFFSIGRDIKQR
LSDTDSRAEPATIKISQTDQAAGAGQATQKSACCGT

MAAPPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELD
GKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDN
VNKILVGNKADMDESKRAVPKSKGQALADEYGIKFFETSAKTNLNVEEVFFSIAKDIKQR
LADTDSRAEPATIKISQTDQAAGAGQATQKSACCGS

www.000webhost.com

Other information
Ka divergence:-0.338763KaKs divergence:-0.53902
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):651Length 2 (bp):651Length divergence:0
MFE 1 (kcal):-201.9MFE 2 (kcal):-185.17MFE divergence-0.043