Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46110-AT5G59790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Domain of unknown function (DUF966)
Function (paralog2):Domain of unknown function (DUF966)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.43797074197819
Log2 mRNA fold difference:-0.10015313957177
Log2 TE fold difference:0.34650352696778
Sequences
Protein sequence

MALVSSRATQDSKPSRERIVPVVYYLSRNGRLDHPHFIEVPLSSHNGLYLKDVINRLNDL
RGNGMACLYSWSSKRTYKNGFVWYDLSDEDFIFPVHGQEYVLKGSQILDLDNNSGNFSAV
THRRNQSWSSVDHYKVYKASELNAEATRKLSMDASTQTDDRRRRKSPVDEVNEVTELSRE
EITSPPQSDSSPETLESLMRADGRLILLQEDQELNRTVEKMRPSAVLMQLISCGAMSFKK
CGPTLMNGNTRSTAVRGTGNYRLERAEKELKSFGRVKLEEKEYFSGSLIDESSKKELVPA
LKRSSSYNIDRSSRMGLTKEKEGEELARANFIPRNPNSVVGQP

MSSRVFRATPDNNYLVPRRSKDQQDTSPDRNRIWSEPRLKPVVNRKVPVVYYLCRNGQLD
HPHFIEVTLSSHDGLYLKDVINRLNDLRGKGMASLYSWSSKRSYKNGFVWHDLSEDDFIF
PVQGQEYVLKGSEVLDSCLISNPRSLLETSSFRDPRSLNPDKNSGDDIPAVINRRRNQSW
SSIDLSEYKVYKATESSAESTQRLAADASTQTDDRRRRRRPAKEEIEEVKSPASYENQST
ELSRDEISPPPSDSSPETLENLIKADGRLILRPSESSTDHRTVESLSSGRMRASAVLMQL
ISCGTMSFKECGPVLLKDQGLALNGRSGCTITRGAEDNGEERVDKELKSFGRVQLEDKEY
FSGSLIETKKELVPALKRSSSYNADRCSRMGPTTEKDEEEAVRAKCIPRKPKPVAKRNNG
GQQ

Other information
Ka divergence:-0.426358KaKs divergence:-0.0204974
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):1032Length 2 (bp):1272Length divergence:0.104
MFE 1 (kcal):-318.5MFE 2 (kcal):-405.01MFE divergence0.12