Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46130-AT5G59780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 48
Function (paralog2):myb domain protein 59

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.359833964432
Log2 mRNA fold difference:2.0661780504454
Log2 TE fold difference:-0.71823688839205
Sequences
Protein sequence

MMQEEGNRKGPWTEQEDILLVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGL
KRGKMTPQEERLVLELHAKWGNRWSKIARKLPGRTDNEIKNYWRTHMRKKAQEKKRPVSP
TSSFSNCSSSSVTTTTTNTQDTSCHSRKSSGEVSFYDTGGSRSTREMNQENEDVYSLDDI
WREIDHSAVNIIKPVKDIYSEQSHCLSYPNLASPSWESSLDSIWNMDADKSKISSYFAND
QFPFCFQHSRSPWSSG

MKLVQEEYRKGPWTEQEDILLVNFVHLFGDRRWDFVAKVSGLNRTGKSCRLRWVNYLHPG
LKRGKMTPQEERLVLELHAKWGNRWSKIARKLPGRTDNEIKNYWRTHMRKKAQEKKRPMS
PTSSSSNCCSSSMTTTTSQDTGGSNGKMNQECEDGYYSMDDIWREIDQSGANVIKPVKDN
YYSEQSCYLNFPPLASPTWESSLESIWNMDADESKMSSFAIDQFPLSFEHGSGRL

Other information
Ka divergence:-0.181184KaKs divergence:-0.11981
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):771Length 2 (bp):708Length divergence:-0.043
MFE 1 (kcal):-216.44MFE 2 (kcal):-211.06MFE divergence-0.013