Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46230-AT5G59720
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):heat shock protein 17.4
Function (paralog2):heat shock protein 18.2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.79447050839807
Log2 mRNA fold difference:0.30437270560461
Log2 TE fold difference:0.15101565296101
Sequences
Protein sequence

MSLVPSFFGGRRTNVFDPFSLDVWDPFEGFLTPGLTNAPAKDVAAFTNAKVDWRETPEAH
VFKADVPGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWHRVERSSGKFMRRFRLPEN
AKVEEVKASMENGVLSVTVPKVQESKPEVKSVDISG

MSLIPSIFGGRRSNVFDPFSQDLWDPFEGFFTPSSALANASTARDVAAFTNARVDWKETP
EAHVFKADLPGLKKEEVKVEVEDKNVLQISGERSKENEEKNDKWHRVERASGKFMRRFRL
PENAKMEEVKATMENGVLTVVVPKAPEKKPQVKSIDISGAN

www.000webhost.com

Other information
Ka divergence:-0.0337499KaKs divergence:-0.999942
GC content 1 (%):51GC content 2 (%):48GC content divergence:-0.03
Length 1 (bp):471Length 2 (bp):486Length divergence:0.016
MFE 1 (kcal):-152.4MFE 2 (kcal):-147.8MFE divergence-0.015