Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46290-AT5G59700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):hercules receptor kinase 1
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.3161672933674
Log2 mRNA fold difference:-2.1696697790109
Log2 TE fold difference:-0.073914755011744
Sequences
Protein sequence

MGIEKFETFILISTISILLCICHGFTPVDNYLINCGSPTNGTLMGRIFLSDKLSSKLLTS
SKEILASVGGNSGSDIYHTARVFTEVSSYKFSVTRGRHWVRLYFNPFDYQNFKMGSAKFA
VSSQSHVLLSDFTVTSSKVVKEYSLNVTTNDLVLTFTPSSGSFAFVNAIEVISIPDTLIT
GSPRFVGNPAQFPDMSMQGLETIHRVNMGGPLVASNNDTLTRTWVPDSEFLLEKNLAKSM
SKFSTVNFVPGYATEDSAPRTVYGSCTEMNSADNPNSIFNVTWEFDVDPGFQYYFRFHFC
DIVSLSLNQLYFNLYVDSMVAATDIDLSTLVDNTLAGAYSMDFVTQTPKGSNKVRVSIGP
STVHTDYPNAIVNGLEIMKMNNSKGQLSTGTFVPGSSSSSKSNLGLIVGSAIGSLLAVVF
LGSCFVLYKKRKRGQDGHSKTWMPFSINGTSMGSKYSNGTTLTSITTNANYRIPFAAVKD
ATNNFDESRNIGVGGFGKVYKGELNDGTKVAVKRGNPKSQQGLAEFRTEIEMLSQFRHRH
LVSLIGYCDENNEMILIYEYMENGTVKSHLYGSGLPSLTWKQRLEICIGAARGLHYLHTG
DSKPVIHRDVKSANILLDENFMAKVADFGLSKTGPELDQTHVSTAVKGSFGYLDPEYFRR
QQLTDKSDVYSFGVVLFEVLCARPVIDPTLPREMVNLAEWAMKWQKKGQLDQIIDQSLRG
NIRPDSLRKFAETGEKCLADYGVDRPSMGDVLWNLEYALQLQEAVIDGEPEDNSTNMIGE
LPPQINNFSQGDTSVNVPGTAGRFEESSIDDLSGVSMSKVFSQLVKSEGR

MGGEKFGFLIWILSIPCLIFLCYGYVPVDNYLINCGSSTNVTVTSRVFISDNLASNFLTS
PNEILAASNRNSNSDIYQTARIFTGISKYRFSVARGRHWIRLHFNPFQYQNFQMVSAKFS
VSSETHVLLSDFTVSSRVMKEYSLNVATDHLELTFTPSGDSFAFLNALEVVSVPDTLFSG
DPSFAGSPGKFQGLSWQALETVYRVNMGGPRVTPSNDTLSRIWEPDSEFLVEKNLVKSVS
KIASVDYVPGFATEETAPRTVYGTCTEMNSADNPSSNFNVTWDFDVDPGFQYFLRFHFCD
IVSKALNQLYFNLYVDSMDVVENLDLSSYLSNTLSGAYAMDFVTGSAKLTKRIRVSIGRS
SVHTDYPTAILNGLEIMKMNNSKSQLSIGTFLPSGSSSTTKKNVGMIIGLTIGSLLALVV
LGGFFVLYKKRGRDQDGNSKTWIPLSSNGTTSSSNGTTLASIASNSSYRIPLVAVKEATN
SFDENRAIGVGGFGKVYKGELHDGTKVAVKRANPKSQQGLAEFRTEIEMLSQFRHRHLVS
LIGYCDENNEMILVYEYMENGTLKSHLYGSGLLSLSWKQRLEICIGSARGLHYLHTGDAK
PVIHRDVKSANILLDENLMAKVADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQL
TEKSDVYSFGVVMFEVLCARPVIDPTLTREMVNLAEWAMKWQKKGQLEHIIDPSLRGKIR
PDSLRKFGETGEKCLADYGVDRPSMGDVLWNLEYALQLQEAVVDGDPEDSTNMIGELPLR
FNDYNHGDTSVNFSVAKEGRFDEEESSVDDSSGVSMSKVFSQLIKSEGR

www.000webhost.com

Other information
Ka divergence:0.0725023KaKs divergence:0.0817218
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2493Length 2 (bp):2490Length divergence:-0.001
MFE 1 (kcal):-769.73MFE 2 (kcal):-760.43MFE divergence-0.006