Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46440-AT5G59290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-XYL synthase 5
Function (paralog2):UDP-glucuronic acid decarboxylase 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.5126675972495
Log2 mRNA fold difference:1.2477808029392
Log2 TE fold difference:0.32376257539475
Sequences
Protein sequence

MASSDKQTSPKPPPSPSPLRNSKFCQSNMRILISGGAGFIGSHLVDKLMENEKNEVIVAD
NYFTGSKDNLKKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTN
VIGTLNMLGLAKRVGARILLTSTSEVYGDPLIHPQPESYWGNVNPIGVRSCYDEGKRVAE
TLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQALRGEALTVQKPGTQTRSF
CYVSDMVDGLMRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPR
QRKPDITKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVHKN

MTFNAYSGLRSLSQAMAATSEKQNTTKPPPSPSPLRNSKFCQPNMRILISGGAGFIGSHL
VDKLMENEKNEVVVADNYFTGSKENLKKWIGHPRFELIRHDVTEPLLIEVDRIYHLACPA
SPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLIHPQPESYWGNVN
PIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQALR
GEALTVQKPGTQTRSFCYVSDMVDGLIRLMEGNDTGPINIGNPGEFTMVELAETVKELIN
PSIEIKMVENTPDDPRQRKPDISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNVPRN

www.000webhost.com

Other information
Ka divergence:0.269822KaKs divergence:0.0778098
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1026Length 2 (bp):1074Length divergence:0.023
MFE 1 (kcal):-317.28MFE 2 (kcal):-330.7MFE divergence0.021