Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46460-AT5G59300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ubiquitin-conjugating enzyme 13
Function (paralog2):ubiquitin carrier protein 7

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.017112987563492
Log2 mRNA fold difference:0.071606129571153
Log2 TE fold difference:-0.10400504775422
Sequences
Protein sequence

MNSQACLLLQKQLKDLCKHPVDGFSAGLVDEKNIFEWSVTIIGPPDTLYEGGFFYAIMSF
PQNYPNSPPTVRFTSDIWHPNVYPDGRVCISILHPPGDDPSGYELASERWTPVHTVESIM
LSIISMLSGPNDESPANVEAAKEWREKRDEFKKKVSRCVRKSQEMF

MCSHNENIDSRKFTKSEPCHIKKISISILSISLSSSSMASQASLLLQKQLKDLCKHPVDG
FSAGLVDEKNIFEWSVTIIGPPDTLYEGGFFNAIMTFPQNYPNSPPTVRFTSDMWHPNVY
SDGRVCISILHPPGDDPSGYELASERWTPVHTVESIMLSIISMLSGPNDESPANVEAAKE
WRDKRDEFKKKVSRCVRKSQEMF

www.000webhost.com

Other information
Ka divergence:0.29869KaKs divergence:-0.118081
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):501Length 2 (bp):612Length divergence:0.1
MFE 1 (kcal):-129MFE 2 (kcal):-160.22MFE divergence0.108