Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46520-AT5G59370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):actin-12
Function (paralog2):actin 4

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1891362703188
Log2 mRNA fold difference:1.5962877759519
Log2 TE fold difference:-0.66386062530251
Sequences
Protein sequence

MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
DLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEKLSYIALDYEQELETSKTSSSVEK
SFELPDGQVITIGAERFRCPEVLFQPSMIGMENPGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIA
KAEYDESGPSIVHRKCF

MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
DLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEKLSYIALDFEQELETSKTSSSVEK
SFELPDGQVITIGAERFRCPEVLFQPSMIGMENPGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIA
KAEYDESGPSIVHRKCF

Other information
Ka divergence:-1KaKs divergence:-0.916667
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1134Length 2 (bp):1134Length divergence:0
MFE 1 (kcal):-381.69MFE 2 (kcal):-370.03MFE divergence-0.016