Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46580-AT5G59380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):methyl-CPG-binding domain protein 5
Function (paralog2):methyl-CPG-binding domain 6

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.47472052676851
Log2 mRNA fold difference:-0.16042543806425
Log2 TE fold difference:0.7048177040552
Sequences
Protein sequence

MSNGTDQAQPPPENPATPVDSKSRKRATPGDDNWLPPDWRTEIRVRTSGTKAGTVDKFYY
EPITGRKFRSKNEVLYYLEHGTPKKKSVKTAENGDSHSEHSEGRGSARRQTKSNKKVTEP
PPKPLNFDFLNVPEKVTWTGINGSEEAWLPFIGDYKIQESVSQDWDRVFTLVTSQNAGKT
MF

MSDSVAGDFPPDPLLASGAFISSAGDGTLDSSAKRRPIQGGIGISGSGESVRIGMANGTD
QVNHQTESKSRKRAAPGDNWLPPGWRVEDKIRTSGATAGSVDKYYYEPNTGRKFRSRTEV
LYYLEHGTSKRGTKKAENTYFNPDHFEGQGSNRVTRTATVPPPPPPPLDFDFKNPPDKVS
WSMANAGEEGWIPNIGDVKVQDSVRRDWSTAFTFITSRNPSKVSA

www.000webhost.com

Other information
Ka divergence:0.11904KaKs divergence:0.00359712
GC content 1 (%):48GC content 2 (%):50GC content divergence:0.02
Length 1 (bp):549Length 2 (bp):678Length divergence:0.105
MFE 1 (kcal):-183.29MFE 2 (kcal):-219.7MFE divergence0.09