Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46620-AT5G59550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):zinc finger (C3HC4-type RING finger) family protein
Function (paralog2):zinc finger (C3HC4-type RING finger) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.075142441605099
Log2 mRNA fold difference:-0.69045411476012
Log2 TE fold difference:0.74430146882962
Sequences
Protein sequence

MMPNSRSATITPTTESTTTTTTTTTTLTTSYWCYSCTRFISVWEDQDANAGVLCPYCNGG
FIEEIEDSSNSTVAAIPASTPEVRSVEETHRSIIRRRRSNRRTSFNPVIVLHGGGGGGAG
ERVENEEGDGATRERRAYEFYYDDGSGSGLRPLPDSVSEILMGSGFERLLEQLSQIEASG
NGIGRSGNPPASKSAIESLPRVEISDCHTKAEANCAVCTEVFEAGIEGREMPCKHIFHGD
CIVPWLSIRNSCPVCRFELPSDPIQRSNEEEHAVGMTIWRLPGGGFAVGRFNAGVREGER
ILPVVLTEMDGGGLGSNEGPRRISWVRAHETPEMSRNGGRSGNGGRLRRAVRGMVSFMRR
VRPSRGSSNSNVIDLDSDGETRVMNRSTSLIRRFF

MPSTPTTPTTTTPITASYWCYSCTRFVSVWADQGTTTVGSVACPHCDGGFIEQINDSSSA
ATELTIPASTEVRSINNNRRSVIRRRRSGRRPSFNPVIVLQGGAGEREEGEEGDAARDRR
AFEFYYDDGSGSGLRPLPDSVSEILMGSGFERLLEQLSQIEASATGIGRSGNPPASKSAI
ESLPRVEISDCHIGSEANCAVCTEIFETETEAREMPCKHLFHDDCIVPWLSIRNSCPVCR
FELPSEPNRRSNNNEEDNAVGMTIWRLPGGGFAVGRFNAAMRDGERVLPVVLTEMDGGGI
GNSQDGPRRISWVRSHGTLESDSNGTGSGSGSGGRLRRMVRGMVSLMRRVRPNRSSSSSS
AAISTSSDNLDLNIEVESRVLDRSNSVMRRYFRRNRSNRDSSSSVLH

www.000webhost.com

Other information
Ka divergence:-0.0530371KaKs divergence:0.116376
GC content 1 (%):45GC content 2 (%):50GC content divergence:0.053
Length 1 (bp):1188Length 2 (bp):1224Length divergence:0.015
MFE 1 (kcal):-400.24MFE 2 (kcal):-440MFE divergence0.047