Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46640-AT5G59570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Homeodomain-like superfamily protein
Function (paralog2):Homeodomain-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0988894537547
Log2 mRNA fold difference:-0.98777198990807
Log2 TE fold difference:-0.26807408797373
Sequences
Protein sequence

MGEEVQMSDYDVSGDGDRVSEWEMGLPSDEDLASLSYSLIPPNLAMAFSITPERSRTIQD
VNRASETTLSSLRGGSSGPNTSSSNNNVEEEDRVGSSSPGSDSKKQKTSNGDGDDGGGVD
PDSAMAAEEGDSGTEDLSGKTLKRPRLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNV
EGLTRENVASHLQKYRLYLKRMQGLTNEGPSASDKLFSSTPVPPQSFQDIGGGGGSSGNV
GVPIPGAYGTQQMMQMPVYAHHMGMQGYHHQNHNHDPYHQNHRHHHGAGGNGSWCLQNFL
SFAEFSTAKSQIASVQERIIQSIM

MGKEVMVSDYGDDDGEDAGGGDEYRIPEWEIGLPNGDDLTPLSQYLVPSILALAFSMIPE
RSRTIHDVNRASQITLSSLRSSTNASSVMEEVVDRVESSVPGSDPKKQKKSDGGEAAAVE
DSTAEEGDSGPEDASGKTSKRPRLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGL
TRENVASHLQKYRLYLKRIQGLTTEEDPYSSSDQLFSSTPVPPQSFQDGGGSNGKLGVPV
PVPSMVPIPGYGNQMGMQGYYQQYSNHGNESNQYMMQQNKFGTMVTYPSVGGGDVNDK

www.000webhost.com

Other information
Ka divergence:-0.0144099KaKs divergence:0.605273
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):975Length 2 (bp):897Length divergence:-0.042
MFE 1 (kcal):-326.8MFE 2 (kcal):-293.41MFE divergence-0.054