Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46820-AT5G59160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):type one serine/threonine protein phosphatase 5
Function (paralog2):type one serine/threonine protein phosphatase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1216415133203
Log2 mRNA fold difference:0.27307461669384
Log2 TE fold difference:0.79461355769273
Sequences
Protein sequence

MAQQGQGSMDPAVLDDIIRRLLDYRNPKAGTKQAMLNDSEIRQLCFVSREIFLQQPCLLE
LAAPVKICGDIHGQYSDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKY
PENFFLLRGNHECASINRIYGFYDECKRRFNVKLWKVFTDTFNCLPVAAVIDEKILCMHG
GLSPELINVEQIKNIERPTDVPDAGLLCDLLWSDPSKDVKGWGMNDRGVSYTFGADKVAE
FLIKNDMDLVCRAHQVVEDGYEFFADRQLVTMFSAPNYCGEFDNAGALMSVDESLMCSFQ
ILKPVDRRSRFF

MAQQGQGSMDPAALDDIIRRLLDYRNPKPGTKQAMLNESEIRQLCIVSREIFLQQPNLLE
LEAPIKICGDIHGQYSDLLRLFEYGGFPPTANYLFLGDYVDRGKQSLETICLLLAYKIKY
PENFFLLRGNHECASINRIYGFYDECKRRFSVRLWKVFTDSFNCLPVAAVIDDKILCMHG
GLSPDLTNVEQIKNIKRPTDVPDSGLLCDLLWSDPSKDVKGWGMNDRGVSYTFGPDKVAE
FLIKNDMDLICRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFDNAGAMMSVDESLMCSFQ
ILKPADRKPRFL

Other information
Ka divergence:-0.671381KaKs divergence:-0.568456
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):939Length 2 (bp):939Length divergence:0
MFE 1 (kcal):-274.1MFE 2 (kcal):-272.06MFE divergence-0.004