Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46830-AT5G59150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RAB GTPase homolog A2C
Function (paralog2):RAB GTPase homolog A2D

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.81094948593274
Log2 mRNA fold difference:-1.0758174956323
Log2 TE fold difference:0.26028350816
Sequences
Protein sequence

MTHRVDQEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTTQVEGKT
IKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTFDNVLRWLRELRDHADSNIVI
MMAGNKSDLNHLRSVAEEDGQSLAEKEGLSFLETSALEATNVEKAFQTILGEIYHIISKK
ALAAQEAAAANSAIPGQGTTINVDDTSGGAKRACCSS

MAHRVEQDYDYLFKIVLIGDSGVGKTNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKT
VKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTFDNVLRWLRELRDHADSNIVI
MMAGNKADLNHLRSVAEEDGQTLAETEGLSFLETSALEATNVEKAFQTVLAEIYHIISKK
ALAAQEAAAANSAIPGQGTTINVEDTSGAGKRGCCST

www.000webhost.com

Other information
Ka divergence:0.329846KaKs divergence:-0.831574
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):654Length 2 (bp):654Length divergence:0
MFE 1 (kcal):-193.5MFE 2 (kcal):-196.79MFE divergence0.008