Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46930-AT5G58950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:4.2474416266544
Log2 mRNA fold difference:3.3329793797373
Log2 TE fold difference:0.86260493203334
Sequences
Protein sequence

MDGEVTSWIRRANFSHTVCYRMITPSLESMPFTVNQEKMQRNPVTNKKRSVSPLPHMALS
DAFIEAKSDIKRFSTPHPRRVEPEKGMKAKSSSRKDSSEKKSVNLRSLSHSGPIRDLSTQ
KVKERGKSKIDKKSSKSVDYRGSKVSSAGVLEECLIDVSKLSYGDRFAHGKYSQIYHGEY
EGKAVALKIITAPEDSDDIFLGARLEKEFIVEATLLSRLSHPNVVKFVGVNTGNCIITEY
VPRGSLRSYLHKLEQKSLPLEQLIDFGLDIAKGMEYIHSREIVHQDLKPENVLIDNDFHL
KIADFGIACEEEYCDVLGDNIGTYRWMAPEVLKRIPHGRKCDVYSFGLLLWEMVAGALPY
EEMKFAEQIAYAVIYKKIRPVIPTDCPAAMKELIERCWSSQTDKRPEFWQIVKVLEHFKK
SLTSEGKLNLLPSQICPELKKCPKFWIHIFGSFHHHSSGGGSSSNNSALPKPKFA

MDEEATSWIRRAKFSQTVSYRLNSSKLASLPFMINQDKFSGLKAIPQRSSSSSSASSSDP
KLVSSNSQTTGDTSSLEAADVYVVDSEIQTNPVTHKQRSVSPSPQMAVPDVFKEARSERK
RFSTPHPRRVESEKGMKPKLSHKNSFDKRSFNLRSPSGPIRDLGTLRIQERVKSKKDTGW
SKLFDNTGRRVSAVEASEEFRVDMSKLFFGLKFAHGLYSRLYHGKYEDKAVAVKLITVPD
DDDNGCLGARLEKQFTKEVTLLSRLTHPNVIKFVGAYKDPPVYCVLTQYLPEGSLRSFLH
KPENRSLPLKKLIEFAIDIARGMEYIHSRRIIHRDLKPENVLIDEEFHLKIADFGIACEE
EYCDMLADDPGTYRWMAPEMIKRKPHGRKADVYSFGLVLWEMVAGAIPYEDMNPIQAAFA
VVHKNIRPAIPGDCPVAMKALIEQCWSVAPDKRPEFWQIVKVLEQFAISLEREGNLNLSS
SKICKDPRKGLKHWIQKLGPVHAGGGGGSSSSGLGGSALPKPKFA

Other information
Ka divergence:-0.549898KaKs divergence:-0.497872
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):1428Length 2 (bp):1578Length divergence:0.05
MFE 1 (kcal):-411.1MFE 2 (kcal):-477.66MFE divergence0.075