Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G46990-AT5G58930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF740)
Function (paralog2):Protein of unknown function (DUF740)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.1767937357056
Log2 mRNA fold difference:1.7127843665151
Log2 TE fold difference:0.3383744770513
Sequences
Protein sequence

MANVKQTNRRRSSSSCHRHPSAKPTSGFCASCLRERLVTIEAQSSSLAAVQTPELRRIRS
YSVRNASVSVSDQPRRRSCDVRSSASSLLDLFVDDDEERVDSSIRKPLVPDLKEEEEEEE
EEEDYYDGEDIKGFDEGKPRKIVEENKTMKEFIDLDWRNQIKKNNGKDLKEIASVLSRRL
KNFTLNKRNDEKSDSRFAGIVNGRHSSDVDPRLSFDGGRISFEKPRSSWDGCLIEKSYHK
LTTLSTVTEDAKAKCGVEEEEVEEKEKSPGGTVQTKNYYSDSRRRRSFDRSVSIKRQGLL
EVDELRGISNAKVSPETVGLFHGAKLLVTEKELRDSNWYSIKNVKPESKELVSKGKICIA
AGGEGKKQDSVELKKPRKKWPKGWNIWGLIQRKNEAKNEIKTEQILKLEGNAVEGSLAES
LLKLRRVGKGETNVGVSEKLLKSYSVSARKSCDGVRSGANIVSGFEGGRSSCDGLFHGSI
NSVEAGRNSCDGLVNGIEGKQNHHLLQRNANVGTCSQENLEKSMFRFYLSPVKSHKTSKS
GKSRLKN

MTHQTHQRRRRRHSAVCHRHPSSKPTTGFCATCLRERLSTIEALSSSVSASTELRRVRSY
SVRDASASVLDQPRRRSCDVRSNHDDDDDDELLKSSIRFPIVPDLIEDEEEEDDEGKKLV
EEEIEDGEQKTMKELIDLESRNQQLKNNGKDSVFSRTLRKFSLKHHRKIPDSGNSLGRRS
CDVDPRLSLDAGRVSFDEPRASWDGCLIGKTYPKLIPLSSVTEDVKASPEKITGEKVEED
EKNNPGGTAQTRDYYLDSRRRRSFDRSSRHGLLEVDELKAISNAKVSPETVGLFHGAKLL
VTERELRDSNWYSIKNYKPESLELGSKGVGCVAAGEVKKQDGFGLKKSGKNWSKGWNFWG
LIQRKTDVAKNEMKTEQSLKLGGNTMEGSLAESLLKLRRVAKGETNGDVSEKLIRSYSVS
ARKSCDGMLRGASIVNGFEGGRSSCDGLFHGSITGVETGRRSLCEDGMFHGVEGKRNHLL
QSDDKLGTYSPDNLRNGMVRFYLTPLNSHMTSKSGKSRLMN

Other information
Ka divergence:-0.275148KaKs divergence:-0.442914
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1644Length 2 (bp):1566Length divergence:-0.024
MFE 1 (kcal):-476.62MFE 2 (kcal):-478.76MFE divergence0.002