Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G47000-AT3G47010
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Glycosyl hydrolase family protein
Function (paralog2):Glycosyl hydrolase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.89533021753162
Log2 mRNA fold difference:-0.82228505974025
Log2 TE fold difference:-0.094629984367382
Sequences
Protein sequence

MVVEESSCVYKNGDAPVEARVKDLLSRMTLPEKIGQMTQIERRVASPSAFTDFFIGSVLN
AGGSVPFEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNIGL
GATRDADLVRRIGAATALEVRASGVHWAFSPCVAVLRDPRWGRCYESYGEDPELVCEMTS
LVSGLQGVPPEEHPNGYPFVAGRNNVVACVKHFVGDGGTDKGINEGNTIASYEELEKIHI
PPYLKCLAQGVSTVMASYSSWNGTRLHADRFLLTEILKEKLGFKGFLVSDWEGLDRLSEP
QGSNYRYCIKTAVNAGIDMVMVPFKYEQFIQDMTDLVESGEIPMARINDAVERILRVKFV
AGLFGHPLTDRSLLPTVGCKEHRELAQEAVRKSLVLLKSGKNADKPFLPLDRNAKRILVT
GTHADDLGYQCGGWTKTWFGLSGRITIGTTLLDAIKEAVGDETEVIYEKTPSKETLASSE
GFSYAIVAVGEPPYAETMGDNSELRIPFNGTDIVTAVAEIIPTLVILISGRPVVLEPTVL
EKTEALVAAWLPGTEGQGVADVVFGDYDFKGKLPVSWFKHVEHLPLDAHANSYDPLFPFG
FGLNSKPV

MAETEESSWVYKNRDAPVEARVKDLLSRMTLPEKIGQMTQIERSVASPQVITNSFIGSVQ
SGAGSWPLEDAKSSDWADMIDGFQRSALASRLGIPIIYGTDAVHGNNNVYGATVFPHNIG
LGATRDADLVKRIGAATALEIRASGVHWTFAPCVAVLGDPRWGRCYESYSEAAKIVCEMS
LLISGLQGEPPEEHPYGYPFLAGRNNVIACAKHFVGDGGTEKGLSEGNTITSYEDLEKIH
VAPYLNCIAQGVSTVMASFSSWNGSRLHSDYFLLTEVLKQKLGFKGFLVSDWDGLETISE
PEGSNYRNCVKLGINAGIDMVMVPFKYEQFIQDMTDLVESGEIPMARVNDAVERILRVKF
VAGLFEHPLADRSLLGTVGCKEHREVAREAVRKSLVLLKNGKNADTPFLPLDRNAKRILV
VGMHANDLGNQCGGWTKIKSGQSGRITIGTTLLDSIKAAVGDKTEVIFEKTPTKETLASS
DGFSYAIVAVGEPPYAEMKGDNSELTIPFNGNNIITAVAEKIPTLVILFSGRPMVLEPTV
LEKTEALVAAWFPGTEGQGMSDVIFGDYDFKGKLPVSWFKRVDQLPLNAEANSYDPLFPL
GFGLTSNFG

www.000webhost.com

Other information
Ka divergence:0.165517KaKs divergence:-0.111819
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1827Length 2 (bp):1830Length divergence:0.001
MFE 1 (kcal):-605.11MFE 2 (kcal):-602.51MFE divergence-0.002