Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G47060-AT5G58870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):FTSH protease 7
Function (paralog2):FTSH protease 9

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.1358279280962
Log2 mRNA fold difference:1.7757633787514
Log2 TE fold difference:0.36191937355418
Sequences
Protein sequence

MTTTFEFLQPRIHGFATCCSSNSLLYSKASRFFNDRCRVYRQNPNRFVSNSITLPLQKKQ
VTVLRNHERFNLWDGFSRKKSRLVVNCQEDDQNESSSEEEESSQSTPAKSERKREKKEDK
VWWSKGKKWQWQPIIQAQGIGVLLLQLSVVMFVMRLLRPGIPLPGSEPRIQTTFVSVPYS
EFLSKVNSNQVQKVEVDGVQVLFKLRDDGKWQESETSRLSQSSESLLRTVAPTKRVVYST
TRPGDIKTPYEKMLGNNVEFGSPEKRSGGFFNSALIALFYIAVLAGLIRFPVSFSTSSTG
QLRTRKAGGPDGGKVSGGGETITFADVAGVDEAKEELEEIVEFLRNPEKYVRLGARPPRG
VLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMGASRVRDLFARAKKEAPSI
IFIDEIDAVAKSRDGKFRMGSNDEREQTLNQLLTEMDGFDSNSAVIVLGATNRADVLDPA
LRRPGRFDRVVTVETPDKIGRESILRVHVSKKELPLGDDVNLGSIASMTTGFTGADLANL
VNEAALLAGRKNKTNVEKIDFIQAVERSIAGIEKKSARLKGNEKAVVARHEAGHAVVGTA
VANLLTGQPRVEKLSILPRTGGALGFTYIPPTSEDRYLLFIDELLGRLVTLLGGRAAEEV
VYSGRISTGAFDDIRRATDMAYKAVAEYGLNQKIGPVSVATLSGGGIDDSGGSPWGRDQG
KLVDLVQKEVTILLQSALDVALSVVRANPDVLEGLGAQLEEKEKVEGEELQKWLSMVVAP
EELAVFVEGKQELLLPAQASSS

MTSIELLSPLIHDKFRFSTCCSTSSLLYLHASSFFRDRSFGFRQNPNRFVSNSSIQLPQS
VPGSINQERFNLWQGFSRKKSTSSSRTIVNCQEGDQKASSSEGEGKTNKDKGRKQGKNEL
WWSKGKKWQWKPIIQAQEIGVMLLQLGIVMFVVRLLRPGIPLPGSEPRTQTTFMSVPYSD
FLSKVNNDEVQKVEVDGFHVLFKLKDDGNLQESETSSSSIKLSESSETMLRSVAPTKRVV
YSTTRPRDIKTPYEKMLENNVEFGSPDKRSGGFFNSGLIVLFYIAVLAGLLHRFPVNFSQ
STTGQLRTRKSGGPGGGKVSGDGETITFADVAGVDEAKEELEEIVEFLKNPDRYVRLGAR
PPRGVLLVGLPGTGKTLLAKAVAGESDVPFISCSASEFVELYVGMGASRVRDLFARAKKE
APSIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATNRADV
LDPALRRPGRFDRVVTVESPDKVGRESILKVHVSKKELPLGDDVNLASIASMTTGFTGAD
LANLVNEAALLAGRKSKMTVDKIDFIHAVERSIAGIEKKTARLKGSEKAVVARHEAGHAV
VGTAVASLLSGQSRVEKLSILPRSGGALGFTYIPPTHEDRYLLFIDELHGRLVTLLGGRA
AEEVVYSGRISTGALDDIRRATDMAYKAVAEYGLNEKIGPVSVATLSAGGIDDSGGSPWG
RDQGHLVDLVQREVTNLLQSALDVALTVVRANPDVLEGLGAQLEDEEKVEGEELQKWLNR
VVPSEELAVFIKGKQTALLPAQASSS

Other information
Ka divergence:-0.0484295KaKs divergence:-0.531339
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):2409Length 2 (bp):2421Length divergence:0.002
MFE 1 (kcal):-769.9MFE 2 (kcal):-785.1MFE divergence0.01